欢迎光临~杭州纽罗西敏生物科技有限公司
  咨询电话:0571-88254427

行业新闻及文献

Wuhan seafood market pneumonia virus isolate Wuhan-Hu-1, complete genome

LOCUS       MN908947               30473 bp ss-RNA     linear   VRL 12-JAN-2020
DEFINITION  Wuhan seafood market pneumonia virus isolate Wuhan-Hu-1, complete
            genome.
ACCESSION   MN908947
VERSION     MN908947.1
KEYWORDS    .
SOURCE      Wuhan seafood market pneumonia virus
  ORGANISM  Wuhan seafood market pneumonia virus
            Viruses; Riboviria; Nidovirales; Cornidovirineae; Coronaviridae;
            Orthocoronavirinae; Betacoronavirus; unclassified Betacoronavirus.
REFERENCE   1  (bases 1 to 30473)
  AUTHORS   Zhang,Y.-Z., Wu,F., Chen,Y.-M., Pei,Y.-Y., Xu,L., Wang,W., Zhao,S.,
            Yu,B., Hu,Y., Tao,Z.-W., Song,Z.-G., Tian,J.-H., Zhang,Y.-L.,
            Liu,Y., Zheng,J.-J., Dai,F.-H., Wang,Q.-M., She,J.-L. and Zhu,T.-Y.
  TITLE     A novel coronavirus associated with a respiratory disease in Wuhan
            of Hubei province, China
  JOURNAL   Unpublished
REFERENCE   2  (bases 1 to 30473)
  AUTHORS   Zhang,Y.-Z., Wu,F., Chen,Y.-M., Pei,Y.-Y., Xu,L., Wang,W., Zhao,S.,
            Yu,B., Hu,Y., Tao,Z.-W., Song,Z.-G., Tian,J.-H., Zhang,Y.-L.,
            Liu,Y., Zheng,J.-J., Dai,F.-H., Wang,Q.-M., She,J.-L. and Zhu,T.-Y.
  TITLE     Direct Submission
  JOURNAL   Submitted (05-JAN-2020) Department of Zoonoses, National Institute
            of Communicable Disease Control and Prevention, Chinese Center for
            Disease Control and Prevention, Changping Liuzi 5, Beijing 102206,
            China
COMMENT     [WARNING] On Jan 14, 2020 this sequence was replaced by MN908947.2.
           
            ##Assembly-Data-START##
            Assembly Method       :: Megahit v. V1.1.3
            Sequencing Technology :: Illumina
            ##Assembly-Data-END##
FEATURES             Location/Qualifiers
source 1..30473 /organism="Wuhan seafood market pneumonia virus" /mol_type="genomic RNA" /isolate="Wuhan-Hu-1" /host="Homo sapiens" /db_xref="taxon:2697049" /country="China" /collection_date="Dec-2019" 5'UTR 1..281 gene 282..21571 /gene="orf1ab" CDS join(282..13484,13484..21571) /gene="orf1ab" /ribosomal_slippage /note="pp1ab; translated by -1 ribosomal frameshift" /codon_start=1 /product="ORF1ab polyprotein" /protein_id="QHD43415.1" /translation="MESLVPGFNEKTHVQLSLPVLQVRDVLVRGFGDSVEEVLSEARQ HLKDGTCGLVEVEKGVLPQLEQPYVFIKRSDARTAPHGHVMVELVAELEGIQYGRSGE TLGVLVPHVGEIPVAYRKVLLRKNGNKGAGGHSYGADLKSFDLGDELGTDPYEDFQEN WNTKHSSGVTRELMRELNGGAYTRYVDNNFCGPDGYPLECIKDLLARAGKASCTLSEQ LDFIDTKRGVYCCREHEHEIAWYTERSEKSYELQTPFEIKLAKKFDTFNGECPNFVFP LNSIIKTIQPRVEKKKLDGFMGRIRSVYPVASPNECNQMCLSTLMKCDHCGETSWQTG DFVKATCEFCGTENLTKEGATTCGYLPQNAVVKIYCPACHNSEVGPEHSLAEYHNESG LKTILRKGGRTIAFGGCVFSYVGCHNKCAYWVPRASANIGCNHTGVVGEGSEGLNDNL LEILQKEKVNINIVGDFKLNEEIAIILASFSASTSAFVETVKGLDYKAFKQIVESCGN FKVTKGKAKKGAWNIGEQKSILSPLYAFASEAARVVRSIFSRTLETAQNSVRVLQKAA ITILDGISQYSLRLIDAMMFTSDLATNNLVVMAYITGGVVQLTSQWLTNIFGTVYEKL KPVLDWLEEKFKEGVEFLRDGWEIVKFISTCACEIVGGQIVTCAKEIKESVQTFFKLV NKFLALCADSIIIGGAKLKALNLGETFVTHSKGLYRKCVKSREETGLLMPLKAPKEII FLEGETLPTEVLTEEVVLKTGDLQPLEQPTSEAVEAPLVGTPVCINGLMLLEIKDTEK YCALAPNMMVTNNTFTLKGGAPTKVTFGDDTVIEVQGYKSVNITFELDERIDKVLNEK CSAYTVELGTEVNEFACVVADAVIKTLQPVSELLTPLGIDLDEWSMATYYLFDESGEF KLASHMYCSFYPPDEDEEEGDCEEEEFEPSTQYEYGTEDDYQGKPLEFGATSAALQPE EEQEEDWLDDDSQQTVGQQDGSEDNQTTTIQTIVEVQPQLEMELTPVVQTIEVNSFSG YLKLTDNVYIKNADIVEEAKKVKPTVVVNAANVYLKHGGGVAGALNKATNNAMQVESD DYIATNGPLKVGGSCVLSGHNLAKHCLHVVGPNVNKGEDIQLLKSAYENFNQHEVLLA PLLSAGIFGADPIHSLRVCVDTVRTNVYLAVFDKNLYDKLVSSFLEMKSEKQVEQKIA EIPKEEVKPFITESKPSVEQRKQDDKKIKACVEEVTTTLEETKFLTENLLLYIDINGN LHPDSATLVSDIDITFLKKDAPYIVGDVVQEGVLTAVVIPTKKAGGTTEMLAKALRKV PTDNYITTYPGQGLNGYTVEEAKTVLKKCKSAFYILPSIISNEKQEILGTVSWNLREM LAHAEETRKLMPVCVETKAIVSTIQRKYKGIKIQEGVVDYGARFYFYTSKTTVASLIN TLNDLNETLVTMPLGYVTHGLNLEEAARYMRSLKVPATVSVSSPDAVTAYNGYLTSSS KTPEEHFIETISLAGSYKDWSYSGQSTQLGIEFLKRGDKSVYYTSNPTTFHLDGEVIT FDNLKTLLSLREVRTIKVFTTVDNINLHTQVVDMSMTYGQQFGPTYLDGADVTKIKPH NSHEGKTFYVLPNDDTLRVEAFEYYHTTDPSFLGRYMSALNHTKKWKYPQVNGLTSIK WADNNCYLATALLTLQQIELKFNPPALQDAYYRARAGEAANFCALILAYCNKTVGELG DVRETMSYLFQHANLDSCKRVLNVVCKTCGQQQTTLKGVEAVMYMGTLSYEQFKKGVQ IPCTCGKQATKYLVQQESPFVMMSAPPAQYELKHGTFTCASEYTGNYQCGHYKHITSK ETLYCIDGALLTKSSEYKGPITDVFYKENSYTTTIKPVTYKLDGVVCTEIDPKLDNYY KKDNSYFTEQPIDLVPNQPYPNASFDNFKFVCDNIKFADDLNQLTGYKKPASRELKVT FFPDLNGDVVAIDYKHYTPSFKKGAKLLHKPIVWHVNNATNKATYKPNTWCIRCLWST KPVETSNSFDVLKSEDAQGMDNLACEDLKPVSEEVVENPTIQKDVLECNVKTTEVVGD IILKPANNSLKITEEVGHTDLMAAYVDNSSLTIKKPNELSRVLGLKTLATHGLAAVNS VPWDTIANYAKPFLNKVVSTTTNIVTRCLNRVCTNYMPYFFTLLLQLCTFTRSTNSRI KASMPTTIAKNTVKSVGKFCLEASFNYLKSPNFSKLINIIIWFLLLSVCLGSLIYSTA ALGVLMSNLGMPSYCTGYREGYLNSTNVTIATYCTGSIPCSVCLSGLDSLDTYPSLET IQITISSFKWDLTAFGLVAEWFLAYILFTRFFYVLGLAAIMQLFFSYFAVHFISNSWL MWLIINLVQMAPISAMVRMYIFFASFYYVWKSYVHVVDGCNSSTCMMCYKRNRATRVE CTTIVNGVRRSFYVYANGGKGFCKLHNWNCVNCDTFCAGSTFISDEVARDLSLQFKRP INPTDQSSYIVDSVTVKNGSIHLYFDKAGQKTYERHSLSHFVNLDNLRANNTKGSLPI NVIVFDGKSKCEESSAKSASVYYSQLMCQPILLLDQALVSDVGDSAEVAVKMFDAYVN TFSSTFNVPMEKLKTLVATAEAELAKNVSLDNVLSTFISAARQGFVDSDVETKDVVEC LKLSHQSDIEVTGDSCNNYMLTYNKVENMTPRDLGACIDCSARHINAQVAKSHNIALI WNVKDFMSLSEQLRKQIRSAAKKNNLPFKLTCATTRQVVNVVTTKIALKGGKIVNNWL KQLIKVTLVFLFVAAIFYLITPVHVMSKHTDFSSEIIGYKAIDGGVTRDIASTDTCFA NKHADFDTWFSQRGGSYTNDKACPLIAAVITREVGFVVPGLPGTILRTTNGDFLHFLP RVFSAVGNICYTPSKLIEYTDFATSACVLAAECTIFKDASGKPVPYCYDTNVLEGSVA YESLRPDTRYVLMDGSIIQFPNTYLEGSVRVVTTFDSEYCRHGTCERSEAGVCVSTSG RWVLNNDYYRSLPGVFCGVDAVNLLTNMFTPLIQPIGALDISASIVAGGIVAIVVTCL AYYFMRFRRAFGEYSHVVAFNTLLFLMSFTVLCLTPVYSFLPGVYSVIYLYLTFYLTN DVSFLAHIQWMVMFTPLVPFWITIAYIICISTKHFYWFFSNYLKRRVVFNGVSFSTFE EAALCTFLLNKEMYLKLRSDVLLPLTQYNRYLALYNKYKYFSGAMDTTSYREAACCHL AKALNDFSNSGSDVLYQPPQTSITSAVLQSGFRKMAFPSGKVEGCMVQVTCGTTTLNG LWLDDVVYCPRHVICTSEDMLNPNYEDLLIRKSNHNFLVQAGNVQLRVIGHSMQNCVL KLKVDTANPKTPKYKFVRIQPGQTFSVLACYNGSPSGVYQCAMRPNFTIKGSFLNGSC GSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGNFYGPFVDRQTAQAAGTDTTITVN VLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYEPLTQDHVDILGPLSAQTGIAV LDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQCSGVTFQSAVKRTIKGTHHW LLLTILTSLLVLVQSTQWSLFFFLYENAFLPFAMGIIAMSAFAMMFVKHKHAFLCLFL LPSLATVAYFNMVYMPASWVMRIMTWLDMVDTSLSGFKLKDCVMYASAVVLLILMTAR TVYDDGARRVWTLMNVLTLVYKVYYGNALDQAISMWALIISVTSNYSGVVTTVMFLAR GIVFMCVEYCPIFFITGNTLQCIMLVYCFLGYFCTCYFGLFCLLNRYFRLTLGVYDYL VSTQEFRYMNSQGLLPPKNSIDAFKLNIKLLGVGGKPCIKVATVQSKMSDVKCTSVVL LSVLQQLRVESSSKLWAQCVQLHNDILLAKDTTEAFEKMVSLLSVLLSMQGAVDINKL CEEMLDNRATLQAIASEFSSLPSYAAFATAQEAYEQAVANGDSEVVLKKLKKSLNVAK SEFDRDAAMQRKLEKMADQAMTQMYKQARSEDKRAKVTSAMQTMLFTMLRKLDNDALN NIINNARDGCVPLNIIPLTTAAKLMVVIPDYNTYKNTCDGTTFTYASALWEIQQVVDA DSKIVQLSEISMDNSPNLAWPLIVTALRANSAVKLQNNELSPVALRQMSCAAGTTQTA CTDDNALAYYNTTKGGRFVLALLSDLQDLKWARFPKSDGTGTIYTELEPPCRFVTDTP KGPKVKYLYFIKGLNNLNRGMVLGSLAATVRLQAGNATEVPANSTVLSFCAFAVDAAK AYKDYLASGGQPITNCVKMLCTHTGTGQAITVTPEANMDQESFGGASCCLYCRCHIDH PNPKGFCDLKGKYVQIPTTCANDPVGFTLKNTVCTVCGMWKGYGCSCDQLREPMLQSA DAQSFLNRVCGVSAARLTPCGTGTSTDVVYRAFDIYNDKVAGFAKFLKTNCCRFQEKD EDDNLIDSYFVVKRHTFSNYQHEETIYNLLKDCPAVAKHDFFKFRIDGDMVPHISRQR LTKYTMADLVYALRHFDEGNCDTLKEILVTYNCCDDDYFNKKDWYDFVENPDILRVYA NLGERVRQALLKTVQFCDAMRNAGIVGVLTLDNQDLNGNWYDFGDFIQTTPGSGVPVV DSYYSLLMPILTLTRALTAESHVDTDLTKPYIKWDLLKYDFTEERLKLFDRYFKYWDQ TYHPNCVNCLDDRCILHCANFNVLFSTVFPPTSFGPLVRKIFVDGVPFVVSTGYHFRE LGVVHNQDVNLHSSRLSFKELLVYAADPAMHAASGNLLLDKRTTCFSVAALTNNVAFQ TVKPGNFNKDFYDFAVSKGFFKEGSSVELKHFFFAQDGNAAISDYDYYRYNLPTMCDI RQLLFVVEVVDKYFDCYDGGCINANQVIVNNLDKSAGFPFNKWGKARLYYDSMSYEDQ DALFAYTKRNVIPTITQMNLKYAISAKNRARTVAGVSICSTMTNRQFHQKLLKSIAAT RGATVVIGTSKFYGGWHNMLKTVYSDVENPHLMGWDYPKCDRAMPNMLRIMASLVLAR KHTTCCSLSHRFYRLANECAQVLSEMVMCGGSLYVKPGGTSSGDATTAYANSVFNICQ AVTANVNALLSTDGNKIADKYVRNLQHRLYECLYRNRDVDTDFVNEFYAYLRKHFSMM ILSDDAVVCFNSTYASQGLVASIKNFKSVLYYQNNVFMSEAKCWTETDLTKGPHEFCS QHTMLVKQGDDYVYLPYPDPSRILGAGCFVDDIVKTDGTLMIERFVSLAIDAYPLTKH PNQEYADVFHLYLQYIRKLHDELTGHMLDMYSVMLTNDNTSRYWEPEFYEAMYTPHTV LQAVGACVLCNSQTSLRCGACIRRPFLCCKCCYDHVISTSHKLVLSVNPYVCNAPGCD VTDVTQLYLGGMSYYCKSHKPPISFPLCANGQVFGLYKNTCVGSDNVTDFNAIATCDW TNAGDYILANTCTERLKLFAAETLKATEETFKLSYGIATVREVLSDRELHLSWEVGKP RPPLNRNYVFTGYRVTKNSKVQIGEYTFEKGDYGDAVVYRGTTTYKLNVGDYFVLTSH TVMPLSAPTLVPQEHYVRITGLYPTLNISDEFSSNVANYQKVGMQKYSTLQGPPGTGK SHFAIGLALYYPSARIVYTACSHAAVDALCEKALKYLPIDKCSRIIPARARVECFDKF KVNSTLEQYVFCTVNALPETTADIVVFDEISMATNYDLSVVNARLRAKHYVYIGDPAQ LPAPRTLLTKGTLEPEYFNSVCRLMKTIGPDMFLGTCRRCPAEIVDTVSALVYDNKLK AHKDKSAQCFKMFYKGVITHDVSSAINRPQIGVVREFLTRNPAWRKAVFISPYNSQNA VASKILGLPTQTVDSSQGSEYDYVIFTQTTETAHSCNVNRFNVAITRAKVGILCIMSD RDLYDKLQFTSLEIPRRNVATLQAENVTGLFKDCSKVITGLHPTQAPTHLSVDTKFKT EGLCVDIPGIPKDMTYRRLISMMGFKMNYQVNGYPNMFITREEAIRHVRAWIGFDVEG CHATREAVGTNLPLQLGFSTGVNLVAVPTGYVDTPNNTDFSRVSAKPPPGDQFKHLIP LMYKGLPWNVVRIKIVQMLSDTLKNLSDRVVFVLWAHGFELTSMKYFVKIGPERTCCL CDRRATCFSTASDTYACWHHSIGFDYVYNPFMIDVQQWGFTGNLQSNHDLYCQVHGNA HVASCDAIMTRCLAVHECFVKRVDWTIEYPIIGDELKINAACRKVQHMVVKAALLADK FPVLHDIGNPKAIKCVPQADVEWKFYDAQPCSDKAYKIEELFYSYATHSDKFTDGVCL FWNCNVDRYPANSIVCRFDTRVLSNLNLPGCDGGSLYVNKHAFHTPAFDKSAFVNLKQ LPFFYYSDSPCESHGKQVVSDIDYVPLKSATCITRCNLGGAVCRHHANEYRLYLDAYN MMISAGFSLWVYKQFDTYNLWNTFTRLQSLENVAFNVVNKGHFDGQQGEVPVSIINNT VYTKVDGVDVELFENKTTLPVNVAFELWAKRNIKPVPEVKILNNLGVDIAANTVIWDY KRDAPAHISTIGVCSMTDIAKKPTETICAPLTVFFDGRVDGQVDLFRNARNGVLITEG SVKGLQPSVGPKQASLNGVTLIGEAVKTQFNYYKKVDGVVQQLPETYFTQSRNLQEFK PRSQMEIDFLELAMDEFIERYKLEGYAFEHIVYGDFSHSQLGGLHLLIGLAKRFKESP FELEDFIPMDSTVKNYFITDAQTGSSKCVCSVIDLLLDDFVEIIKSQDLSVVSKVVKV TIDYTEISFMLWCKDGHVETFYPKLQSSQAWQPGVAMPNLYKMQRMLLEKCDLQNYGD SATLPKGIMMNVAKYTQLCQYLNTLTLAVPYNMRVIHFGAGSDKGVAPGTAVLRQWLP TGTLLVDSDLNDFVSDADSTLIGDCATVHTANKWDLIISDMYDPKTKNVTKENDSKEG FFTYICGFIQQKLALGGSVAIKITEHSWNADLYKLMGHFAWWTAFVTNVNASSSEAFL IGCNYLGKPREQIDGYVMHANYIFWRNTNPIQLSSYSLFDMSKFPLKLRGTAVMSLKE GQINDMILSLLSKGRLIIRENNRVVISSDVLVNN" gene 21579..25400 /gene="S" CDS 21579..25400 /gene="S" /note="structural protein" /codon_start=1 /product="surface glycoprotein" /protein_id="QHD43416.1" /translation="MFVFLVLLPLVSSQCVNLTTRTQLPPAYTNSFTRGVYYPDKVFR SSVLHSTQDLFLPFFSNVTWFHAIHVSGTNGTKRFDNPVLPFNDGVYFASTEKSNIIR GWIFGTTLDSKTQSLLIVNNATNVVIKVCEFQFCNDPFLGVYYHKNNKSWMESEFRVY SSANNCTFEYVSQPFLMDLEGKQGNFKNLREFVFKNIDGYFKIYSKHTPINLVRDLPQ GFSALEPLVDLPIGINITRFQTLLALHRSYLTPGDSSSGWTAGAAAYYVGYLQPRTFL LKYNENGTITDAVDCALDPLSETKCTLKSFTVEKGIYQTSNFRVQPTESIVRFPNITN LCPFGEVFNATRFASVYAWNRKRISNCVADYSVLYNSASFSTFKCYGVSPTKLNDLCF TNVYADSFVIRGDEVRQIAPGQTGKIADYNYKLPDDFTGCVIAWNSNNLDSKVGGNYN YLYRLFRKSNLKPFERDISTEIYQAGSTPCNGVEGFNCYFPLQSYGFQPTNGVGYQPY RVVVLSFELLHAPATVCGPKKSTNLVKNKCVNFNFNGLTGTGVLTESNKKFLPFQQFG RDIADTTDAVRDPQTLEILDITPCSFGGVSVITPGTNTSNQVAVLYQDVNCTEVPVAI HADQLTPTWRVYSTGSNVFQTRAGCLIGAEHVNNSYECDIPIGAGICASYQTQTNSPR RARSVASQSIIAYTMSLGAENSVAYSNNSIAIPTNFTISVTTEILPVSMTKTSVDCTM YICGDSTECSNLLLQYGSFCTQLNRALTGIAVEQDKNTQEVFAQVKQIYKTPPIKDFG GFNFSQILPDPSKPSKRSFIEDLLFNKVTLADAGFIKQYGDCLGDIAARDLICAQKFN GLTVLPPLLTDEMIAQYTSALLAGTITSGWTFGAGAALQIPFAMQMAYRFNGIGVTQN VLYENQKLIANQFNSAIGKIQDSLSSTASALGKLQDVVNQNAQALNTLVKQLSSNFGA ISSVLNDILSRLDKVEAEVQIDRLITGRLQSLQTYVTQQLIRAAEIRASANLAATKMS ECVLGQSKRVDFCGKGYHLMSFPQSAPHGVVFLHVTYVPAQEKNFTTAPAICHDGKAH FPREGVFVSNGTHWFVTQRNFYEPQIITTDNTFVSGNCDVVIGIVNNTVYDPLQPELD SFKEELDKYFKNHTSPDVDLGDISGINASVVNIQKEIDRLNEVAKNLNESLIDLQELG KYEQYIKWPWYIWLGFIAGLIAIVMVTIMLCCMTSCCSCLKGCCSCGSCCKFDEDDSE PVLKGVKLHYT" gene 25409..26236 /gene="ORF3" CDS 25409..26236 /gene="ORF3" /codon_start=1 /product="ORF3 protein" /protein_id="QHD43417.1" /translation="MDLFMRIFTIGTVTLKQGEIKDATPSDFVRATATIPIQASLPFG WLIVGVALLAVFQSASKIITLKKRWQLALSKGVHFVCNLLLLFVTVYSHLLLVAAGLE APFLYLYALVYFLQSINFVRIIMRLWLCWKCRSKNPLLYDANYFLCWHTNCYDYCIPY NSVTSSIVITSGDGTTSPISEHDYQIGGYTEKWESGVKDCVVLHSYFTSDYYQLYSTQ LSTDTGVEHVTFFIYNKIVDEPEEHVQIHTIDGSSGVVNPVMEPIYDEPTTTTSVPL" gene 26261..26488 /gene="E" CDS 26261..26488 /gene="E" /note="structural protein; E protein" /codon_start=1 /product="envelope protein" /protein_id="QHD43418.1" /translation="MYSFVSEETGTLIVNSVLLFLAFVVFLLVTLAILTALRLCAYCC NIVNVSLVKPSFYVYSRVKNLNSSRVPDLLV" gene 26539..27207 /gene="M" CDS 26539..27207 /gene="M" /note="structural protein" /codon_start=1 /product="membrane glycoprotein" /protein_id="QHD43419.1" /translation="MADSNGTITVEELKKLLEQWNLVIGFLFLTWICLLQFAYANRNR FLYIIKLIFLWLLWPVTLACFVLAAVYRINWITGGIAIAMACLVGLMWLSYFIASFRL FARTRSMWSFNPETNILLNVPLHGTILTRPLLESELVIGAVILRGHLRIAGHHLGRCD IKDLPKEITVATSRTLSYYKLGASQRVAGDSGFAAYSRYRIGNYKLNTDHSSSSDNIA LLVQ" gene 27218..27403 /gene="ORF6" CDS 27218..27403 /gene="ORF6" /codon_start=1 /product="ORF6 protein" /protein_id="QHD43420.1" /translation="MFHLVDFQVTIAEILLIIMRTFKVSIWNLDYIINLIIKNLSKSL TENKYSQLDEEQPMEID" gene 27410..27775 /gene="ORF7" CDS 27410..27775 /gene="ORF7" /codon_start=1 /product="ORF7 protein" /protein_id="QHD43421.1" /translation="MKIILFLALITLATCELYHYQECVRGTTVLLKEPCSSGTYEGNS PFHPLADNKFALTCFSTQFAFACPDGVKHVYQLRARSVSPKLFIRQEEVQELYSPIFL IVAAIVFITLCFTLKRKTE" gene 27910..28275 /gene="ORF8" CDS 27910..28275 /gene="ORF8" /codon_start=1 /product="ORF8 protein" /protein_id="QHD43422.1" /translation="MKFLVFLGIITTVAAFHQECSLQSCTQHQPYVVDDPCPIHFYSK WYIRVGARKSAPLIELCVDEAGSKSPIQYIDIGNYTVSCLPFTINCQEPKLGSLVVRC SFYEDFLEYHDVRVVLDFI" gene 28290..29549 /gene="N" CDS 28290..29549 /gene="N" /note="structural protein" /codon_start=1 /product="nucleocapsid phosphoprotein" /protein_id="QHD43423.1" /translation="MSDNGPQNQRNAPRITFGGPSDSTGSNQNGERSGARSKQRRPQG LPNNTASWFTALTQHGKEDLKFPRGQGVPINTNSSPDDQIGYYRRATRRIRGGDGKMK DLSPRWYFYYLGTGPEAGLPYGANKDGIIWVATEGALNTPKDHIGTRNPANNAAIVLQ LPQGTTLPKGFYAEGSRGGSQASSRSSSRSRNSSRNSTPGSSRGTSPARMAGNGGDAA LALLLLDRLNQLESKMSGKGQQQQGQTVTKKSAAEASKKPRQKRTATKAYNVTQAFGR RGPEQTQGNFGDQELIRQGTDYKHWPQIAQFAPSASAFFGMSRIGMEVTPSGTWLTYT AAIKLDDKDPNFKDQVILLNKHIDAYKTFPPTEPKKDKKKKADETQALPQRQKKQQTV TLLPAADLDDFSKQLQQSMSSADSTQA" 3'UTR 29550..30473 ORIGIN     
        1 cggtgacgca tacaaaacat tcccaccata ccttcccagg taacaaacca accaactttc
       61 gatctcttgt agatctgttc tctaaacgaa ctttaaaatc tgtgtggctg tcactcggct
      121 gcatgcttag tgcactcacg cagtataatt aataactaat tactgtcgtt gacaggacac
      181 gagtaactcg tctatcttct gcaggctgct tacggtttcg tccgtgttgc agccgatcat
      241 cagcacatct aggtttcgtc cgggtgtgac cgaaaggtaa gatggagagc cttgtccctg
      301 gtttcaacga gaaaacacac gtccaactca gtttgcctgt tttacaggtt cgcgacgtgc
      361 tcgtacgtgg ctttggagac tccgtggagg aggtcttatc agaggcacgt caacatctta
      421 aagatggcac ttgtggctta gtagaagttg aaaaaggcgt tttgcctcaa cttgaacagc
      481 cctatgtgtt catcaaacgt tcggatgctc gaactgcacc tcatggtcat gttatggttg
      541 agctggtagc agaactcgaa ggcattcagt acggtcgtag tggtgagaca cttggtgtcc
      601 ttgtccctca tgtgggcgaa ataccagtgg cttaccgcaa ggttcttctt cgtaagaacg
      661 gtaataaagg agctggtggc catagttacg gcgccgatct aaagtcattt gacttaggcg
      721 acgagcttgg cactgatcct tatgaagatt ttcaagaaaa ctggaacact aaacatagca
      781 gtggtgttac ccgtgaactc atgcgtgagc ttaacggagg ggcatacact cgctatgtcg
      841 ataacaactt ctgtggccct gatggctacc ctcttgagtg cattaaagac cttctagcac
      901 gtgctggtaa agcttcatgc actttgtccg aacaactgga ctttattgac actaagaggg
      961 gtgtatactg ctgccgtgaa catgagcatg aaattgcttg gtacacggaa cgttctgaaa
     1021 agagctatga attgcagaca ccttttgaaa ttaaattggc aaagaaattt gacaccttca
     1081 atggggaatg tccaaatttt gtatttccct taaattccat aatcaagact attcaaccaa
     1141 gggttgaaaa gaaaaagctt gatggcttta tgggtagaat tcgatctgtc tatccagttg
     1201 cgtcaccaaa tgaatgcaac caaatgtgcc tttcaactct catgaagtgt gatcattgtg
     1261 gtgaaacttc atggcagacg ggcgattttg ttaaagccac ttgcgaattt tgtggcactg
     1321 agaatttgac taaagaaggt gccactactt gtggttactt accccaaaat gctgttgtta
     1381 aaatttattg tccagcatgt cacaattcag aagtaggacc tgagcatagt cttgccgaat
     1441 accataatga atctggcttg aaaaccattc ttcgtaaggg tggtcgcact attgcctttg
     1501 gaggctgtgt gttctcttat gttggttgcc ataacaagtg tgcctattgg gttccacgtg
     1561 ctagcgctaa cataggttgt aaccatacag gtgttgttgg agaaggttcc gaaggtctta
     1621 atgacaacct tcttgaaata ctccaaaaag agaaagtcaa catcaatatt gttggtgact
     1681 ttaaacttaa tgaagagatc gccattattt tggcatcttt ttctgcttcc acaagtgctt
     1741 ttgtggaaac tgtgaaaggt ttggattata aagcattcaa acaaattgtt gaatcctgtg
     1801 gtaattttaa agttacaaaa ggaaaagcta aaaaaggtgc ctggaatatt ggtgaacaga
     1861 aatcaatact gagtcctctt tatgcatttg catcagaggc tgctcgtgtt gtacgatcaa
     1921 ttttctcccg cactcttgaa actgctcaaa attctgtgcg tgttttacag aaggccgcta
     1981 taacaatact agatggaatt tcacagtatt cactgagact cattgatgct atgatgttca
     2041 catctgattt ggctactaac aatctagttg taatggccta cattacaggt ggtgttgttc
     2101 agttgacttc gcagtggcta actaacatct ttggcactgt ttatgaaaaa ctcaaacccg
     2161 tccttgattg gcttgaagag aagtttaagg aaggtgtaga gtttcttaga gacggttggg
     2221 aaattgttaa atttatctca acctgtgctt gtgaaattgt cggtggacaa attgtcacct
     2281 gtgcaaagga aattaaggag agtgttcaga cattctttaa gcttgtaaat aaatttttgg
     2341 ctttgtgtgc tgactctatc attattggtg gagctaaact taaagccttg aatttaggtg
     2401 aaacatttgt cacgcactca aagggattgt acagaaagtg tgttaaatcc agagaagaaa
     2461 ctggcctact catgcctcta aaagccccaa aagaaattat cttcttagag ggagaaacac
     2521 ttcccacaga agtgttaaca gaggaagttg tcttgaaaac tggtgattta caaccattag
     2581 aacaacctac tagtgaagct gttgaagctc cattggttgg tacaccagtt tgtattaacg
     2641 ggcttatgtt gctcgaaatc aaagacacag aaaagtactg tgcccttgca cctaatatga
     2701 tggtaacaaa caataccttc acactcaaag gcggtgcacc aacaaaggtt acttttggtg
     2761 atgacactgt gatagaagtg caaggttaca agagtgtgaa tatcactttt gaacttgatg
     2821 aaaggattga taaagtactt aatgagaagt gctctgccta tacagttgaa ctcggtacag
     2881 aagtaaatga gttcgcctgt gttgtggcag atgctgtcat aaaaactttg caaccagtat
     2941 ctgaattact tacaccactg ggcattgatt tagatgagtg gagtatggct acatactact
     3001 tatttgatga gtctggtgag tttaaattgg cttcacatat gtattgttct ttctaccctc
     3061 cagatgagga tgaagaagaa ggtgattgtg aagaagaaga gtttgagcca tcaactcaat
     3121 atgagtatgg tactgaagat gattaccaag gtaaaccttt ggaatttggt gccacttctg
     3181 ctgctcttca acctgaagaa gagcaagaag aagattggtt agatgatgat agtcaacaaa
     3241 ctgttggtca acaagacggc agtgaggaca atcagacaac tactattcaa acaattgttg
     3301 aggttcaacc tcaattagag atggaactta caccagttgt tcagactatt gaagtgaata
     3361 gttttagtgg ttatttaaaa cttactgaca atgtatacat taaaaatgca gacattgtgg
     3421 aagaagctaa aaaggtaaaa ccaacagtgg ttgttaatgc agccaatgtt taccttaaac
     3481 atggaggagg tgttgcagga gccttaaata aggctactaa caatgccatg caagttgaat
     3541 ctgatgatta catagctact aatggaccac ttaaagtggg tggtagttgt gttttaagcg
     3601 gacacaatct tgctaaacac tgtcttcatg ttgtcggccc aaatgttaac aaaggtgaag
     3661 acattcaact tcttaagagt gcttatgaaa attttaatca gcacgaagtt ctacttgcac
     3721 cattattatc agctggtatt tttggtgctg accctataca ttctttaaga gtttgtgtag
     3781 atactgttcg cacaaatgtc tacttagctg tctttgataa aaatctctat gacaaacttg
     3841 tttcaagctt tttggaaatg aagagtgaaa agcaagttga acaaaagatc gctgagattc
     3901 ctaaagagga agttaagcca tttataactg aaagtaaacc ttcagttgaa cagagaaaac
     3961 aagatgataa gaaaatcaaa gcttgtgttg aagaagttac aacaactctg gaagaaacta
     4021 agttcctcac agaaaacttg ttactttata ttgacattaa tggcaatctt catccagatt
     4081 ctgccactct tgttagtgac attgacatca ctttcttaaa gaaagatgct ccatatatag
     4141 tgggtgatgt tgttcaagag ggtgttttaa ctgctgtggt tatacctact aaaaaggctg
     4201 gtggcactac tgaaatgcta gcgaaagctt tgagaaaagt gccaacagac aattatataa
     4261 ccacttaccc gggtcagggt ttaaatggtt acactgtaga ggaggcaaag acagtgctta
     4321 aaaagtgtaa aagtgccttt tacattctac catctattat ctctaatgag aagcaagaaa
     4381 ttcttggaac tgtttcttgg aatttgcgag aaatgcttgc acatgcagaa gaaacacgca
     4441 aattaatgcc tgtctgtgtg gaaactaaag ccatagtttc aactatacag cgtaaatata
     4501 agggtattaa aatacaagag ggtgtggttg attatggtgc tagattttac ttttacacca
     4561 gtaaaacaac tgtagcgtca cttatcaaca cacttaacga tctaaatgaa actcttgtta
     4621 caatgccact tggctatgta acacatggct taaatttgga agaagctgct cggtatatga
     4681 gatctctcaa agtgccagct acagtttctg tttcttcacc tgatgctgtt acagcgtata
     4741 atggttatct tacttcttct tctaaaacac ctgaagaaca ttttattgaa accatctcac
     4801 ttgctggttc ctataaagat tggtcctatt ctggacaatc tacacaacta ggtatagaat
     4861 ttcttaagag aggtgataaa agtgtatatt acactagtaa tcctaccaca ttccacctag
     4921 atggtgaagt tatcaccttt gacaatctta agacacttct ttctttgaga gaagtgagga
     4981 ctattaaggt gtttacaaca gtagacaaca ttaacctcca cacgcaagtt gtggacatgt
     5041 caatgacata tggacaacag tttggtccaa cttatttgga tggagctgat gttactaaaa
     5101 taaaacctca taattcacat gaaggtaaaa cattttatgt tttacctaat gatgacactc
     5161 tacgtgttga ggcttttgag tactaccaca caactgatcc tagttttctg ggtaggtaca
     5221 tgtcagcatt aaatcacact aaaaagtgga aatacccaca agttaatggt ttaacttcta
     5281 ttaaatgggc agataacaac tgttatcttg ccactgcatt gttaacactc caacaaatag
     5341 agttgaagtt taatccacct gctctacaag atgcttatta cagagcaagg gctggtgaag
     5401 ctgctaactt ttgtgcactt atcttagcct actgtaataa gacagtaggt gagttaggtg
     5461 atgttagaga aacaatgagt tacttgtttc aacatgccaa tttagattct tgcaaaagag
     5521 tcttgaacgt ggtgtgtaaa acttgtggac aacagcagac aacccttaag ggtgtagaag
     5581 ctgttatgta catgggcaca ctttcttatg aacaatttaa gaaaggtgtt cagatacctt
     5641 gtacgtgtgg taaacaagct acaaaatatc tagtacaaca ggagtcacct tttgttatga
     5701 tgtcagcacc acctgctcag tatgaactta agcatggtac atttacttgt gctagtgagt
     5761 acactggtaa ttaccagtgt ggtcactata aacatataac ttctaaagaa actttgtatt
     5821 gcatagacgg tgctttactt acaaagtcct cagaatacaa aggtcctatt acggatgttt
     5881 tctacaaaga aaacagttac acaacaacca taaaaccagt tacttataaa ttggatggtg
     5941 ttgtttgtac agaaattgac cctaagttgg acaattatta taagaaagac aattcttatt
     6001 tcacagagca accaattgat cttgtaccaa accaaccata tccaaacgca agcttcgata
     6061 attttaagtt tgtatgtgat aatatcaaat ttgctgatga tttaaaccag ttaactggtt
     6121 ataagaaacc tgcttcaaga gagcttaaag ttacattttt ccctgactta aatggtgatg
     6181 tggtggctat tgattataaa cactacacac cctcttttaa gaaaggagct aaattgttac
     6241 ataaacctat tgtttggcat gttaacaatg caactaataa agccacgtat aaaccaaata
     6301 cctggtgtat acgttgtctt tggagcacaa aaccagttga aacatcaaat tcgtttgatg
     6361 tactgaagtc agaggacgcg cagggaatgg ataatcttgc ctgcgaagat ctaaaaccag
     6421 tctctgaaga agtagtggaa aatcctacca tacagaaaga cgttcttgag tgtaatgtga
     6481 aaactaccga agttgtagga gacattatac ttaaaccagc aaataatagt ttaaaaatta
     6541 cagaagaggt tggccacaca gatctaatgg ctgcttatgt agacaattct agtcttacta
     6601 ttaagaaacc taatgaatta tctagagtat taggtttgaa aacccttgct actcatggtt
     6661 tagctgctgt taatagtgtc ccttgggata ctatagctaa ttatgctaag ccttttctta
     6721 acaaagttgt tagtacaact actaacatag ttacacggtg tttaaaccgt gtttgtacta
     6781 attatatgcc ttatttcttt actttattgc tacaattgtg tacttttact agaagtacaa
     6841 attctagaat taaagcatct atgccgacta ctatagcaaa gaatactgtt aagagtgtcg
     6901 gtaaattttg tctagaggct tcatttaatt atttgaagtc acctaatttt tctaaactga
     6961 taaatattat aatttggttt ttactattaa gtgtttgcct aggttcttta atctactcaa
     7021 ccgctgcttt aggtgtttta atgtctaatt taggcatgcc ttcttactgt actggttaca
     7081 gagaaggcta tttgaactct actaatgtca ctattgcaac ctactgtact ggttctatac
     7141 cttgtagtgt ttgtcttagt ggtttagatt ctttagacac ctatccttct ttagaaacta
     7201 tacaaattac catttcatct tttaaatggg atttaactgc ttttggctta gttgcagagt
     7261 ggtttttggc atatattctt ttcactaggt ttttctatgt acttggattg gctgcaatca
     7321 tgcaattgtt tttcagctat tttgcagtac attttattag taattcttgg cttatgtggt
     7381 taataattaa tcttgtacaa atggccccga tttcagctat ggttagaatg tacatcttct
     7441 ttgcatcatt ttattatgta tggaaaagtt atgtgcatgt tgtagacggt tgtaattcat
     7501 caacttgtat gatgtgttac aaacgtaata gagcaacaag agtcgaatgt acaactattg
     7561 ttaatggtgt tagaaggtcc ttttatgtct atgctaatgg aggtaaaggc ttttgcaaac
     7621 tacacaattg gaattgtgtt aattgtgata cattctgtgc tggtagtaca tttattagtg
     7681 atgaagttgc gagagacttg tcactacagt ttaaaagacc aataaatcct actgaccagt
     7741 cttcttacat cgttgatagt gttacagtga agaatggttc catccatctt tactttgata
     7801 aagctggtca aaagacttat gaaagacatt ctctctctca ttttgttaac ttagacaacc
     7861 tgagagctaa taacactaaa ggttcattgc ctattaatgt tatagttttt gatggtaaat
     7921 caaaatgtga agaatcatct gcaaaatcag cgtctgttta ctacagtcag cttatgtgtc
     7981 aacctatact gttactagat caggcattag tgtctgatgt tggtgatagt gcggaagttg
     8041 cagttaaaat gtttgatgct tacgttaata cgttttcatc aacttttaac gtaccaatgg
     8101 aaaaactcaa aacactagtt gcaactgcag aagctgaact tgcaaagaat gtgtccttag
     8161 acaatgtctt atctactttt atttcagcag ctcggcaagg gtttgttgat tcagatgtag
     8221 aaactaaaga tgttgttgaa tgtcttaaat tgtcacatca atctgacata gaagttactg
     8281 gcgatagttg taataactat atgctcacct ataacaaagt tgaaaacatg acaccccgtg
     8341 accttggtgc ttgtattgac tgtagtgcgc gtcatattaa tgcgcaggta gcaaaaagtc
     8401 acaacattgc tttgatatgg aacgttaaag atttcatgtc attgtctgaa caactacgaa
     8461 aacaaatacg tagtgctgct aaaaagaata acttaccttt taagttgaca tgtgcaacta
     8521 ctagacaagt tgttaatgtt gtaacaacaa agatagcact taagggtggt aaaattgtta
     8581 ataattggtt gaagcagtta attaaagtta cacttgtgtt cctttttgtt gctgctattt
     8641 tctatttaat aacacctgtt catgtcatgt ctaaacatac tgacttttca agtgaaatca
     8701 taggatacaa ggctattgat ggtggtgtca ctcgtgacat agcatctaca gatacttgtt
     8761 ttgctaacaa acatgctgat tttgacacat ggtttagcca gcgtggtggt agttatacta
     8821 atgacaaagc ttgcccattg attgctgcag tcataacaag agaagtgggt tttgtcgtgc
     8881 ctggtttgcc tggcacgata ttacgcacaa ctaatggtga ctttttgcat ttcttaccta
     8941 gagtttttag tgcagttggt aacatctgtt acacaccatc aaaacttata gagtacactg
     9001 actttgcaac atcagcttgt gttttggctg ctgaatgtac aatttttaaa gatgcttctg
     9061 gtaagccagt accatattgt tatgatacca atgtactaga aggttctgtt gcttatgaaa
     9121 gtttacgccc tgacacacgt tatgtgctca tggatggctc tattattcaa tttcctaaca
     9181 cctaccttga aggttctgtt agagtggtaa caacttttga ttctgagtac tgtaggcacg
     9241 gcacttgtga aagatcagaa gctggtgttt gtgtatctac tagtggtaga tgggtactta
     9301 acaatgatta ttacagatct ttaccaggag ttttctgtgg tgtagatgct gtaaatttac
     9361 ttactaatat gtttacacca ctaattcaac ctattggtgc tttggacata tcagcatcta
     9421 tagtagctgg tggtattgta gctatcgtag taacatgcct tgcctactat tttatgaggt
     9481 ttagaagagc ttttggtgaa tacagtcatg tagttgcctt taatacttta ctattcctta
     9541 tgtcattcac tgtactctgt ttaacaccag tttactcatt cttacctggt gtttattctg
     9601 ttatttactt gtacttgaca ttttatctta ctaatgatgt ttctttttta gcacatattc
     9661 agtggatggt tatgttcaca cctttagtac ctttctggat aacaattgct tatatcattt
     9721 gtatttccac aaagcatttc tattggttct ttagtaatta cctaaagaga cgtgtagtct
     9781 ttaatggtgt ttcctttagt acttttgaag aagctgcgct gtgcaccttt ttgttaaata
     9841 aagaaatgta tctaaagttg cgtagtgatg tgctattacc tcttacgcaa tataatagat
     9901 acttagctct ttataataag tacaagtatt ttagtggagc aatggataca actagctaca
     9961 gagaagctgc ttgttgtcat ctcgcaaagg ctctcaatga cttcagtaac tcaggttctg
    10021 atgttcttta ccaaccacca caaacctcta tcacctcagc tgttttgcag agtggtttta
    10081 gaaaaatggc attcccatct ggtaaagttg agggttgtat ggtacaagta acttgtggta
    10141 caactacact taacggtctt tggcttgatg acgtagttta ctgtccaaga catgtgatct
    10201 gcacctctga agacatgctt aaccctaatt atgaagattt actcattcgt aagtctaatc
    10261 ataatttctt ggtacaggct ggtaatgttc aactcagggt tattggacat tctatgcaaa
    10321 attgtgtact taagcttaag gttgatacag ccaatcctaa gacacctaag tataagtttg
    10381 ttcgcattca accaggacag actttttcag tgttagcttg ttacaatggt tcaccatctg
    10441 gtgtttacca atgtgctatg aggcccaatt tcactattaa gggttcattc cttaatggtt
    10501 catgtggtag tgttggtttt aacatagatt atgactgtgt ctctttttgt tacatgcacc
    10561 atatggaatt accaactgga gttcatgctg gcacagactt agaaggtaac ttttatggac
    10621 cttttgttga caggcaaaca gcacaagcag ctggtacgga cacaactatt acagttaatg
    10681 ttttagcttg gttgtacgct gctgttataa atggagacag gtggtttctc aatcgattta
    10741 ccacaactct taatgacttt aaccttgtgg ctatgaagta caattatgaa cctctaacac
    10801 aagaccatgt tgacatacta ggacctcttt ctgctcaaac tggaattgcc gttttagata
    10861 tgtgtgcttc attaaaagaa ttactgcaaa atggtatgaa tggacgtacc atattgggta
    10921 gtgctttatt agaagatgaa tttacacctt ttgatgttgt tagacaatgc tcaggtgtta
    10981 ctttccaaag tgcagtgaaa agaacaatca agggtacaca ccactggttg ttactcacaa
    11041 ttttgacttc acttttagtt ttagtccaga gtactcaatg gtctttgttc ttttttttgt
    11101 atgaaaatgc ctttttacct tttgctatgg gtattattgc tatgtctgct tttgcaatga
    11161 tgtttgtcaa acataagcat gcatttctct gtttgttttt gttaccttct cttgccactg
    11221 tagcttattt taatatggtc tatatgcctg ctagttgggt gatgcgtatt atgacatggt
    11281 tggatatggt tgatactagt ttgtctggtt ttaagctaaa agactgtgtt atgtatgcat
    11341 cagctgtagt gttactaatc cttatgacag caagaactgt gtatgatgat ggtgctagga
    11401 gagtgtggac acttatgaat gtcttgacac tcgtttataa agtttattat ggtaatgctt
    11461 tagatcaagc catttccatg tgggctctta taatctctgt tacttctaac tactcaggtg
    11521 tagttacaac tgtcatgttt ttggccagag gtattgtttt tatgtgtgtt gagtattgcc
    11581 ctattttctt cataactggt aatacacttc agtgtataat gctagtttat tgtttcttag
    11641 gctatttttg tacttgttac tttggcctct tttgtttact caaccgctac tttagactga
    11701 ctcttggtgt ttatgattac ttagtttcta cacaggagtt tagatatatg aattcacagg
    11761 gactactccc acccaagaat agcatagatg ccttcaaact caacattaaa ttgttgggtg
    11821 ttggtggcaa accttgtatc aaagtagcca ctgtacagtc taaaatgtca gatgtaaagt
    11881 gcacatcagt agtcttactc tcagttttgc aacaactcag agtagaatca tcatctaaat
    11941 tgtgggctca atgtgtccag ttacacaatg acattctctt agctaaagat actactgaag
    12001 cctttgaaaa aatggtttca ctactttctg ttttgctttc catgcagggt gctgtagaca
    12061 taaacaagct ttgtgaagaa atgctggaca acagggcaac cttacaagct atagcctcag
    12121 agtttagttc ccttccatca tatgcagctt ttgctactgc tcaagaagct tatgagcagg
    12181 ctgttgctaa tggtgattct gaagttgttc ttaaaaagtt gaagaagtct ttgaatgtgg
    12241 ctaaatctga atttgaccgt gatgcagcca tgcaacgtaa gttggaaaag atggctgatc
    12301 aagctatgac ccaaatgtat aaacaggcta gatctgagga caagagggca aaagttacta
    12361 gtgctatgca gacaatgctt ttcactatgc ttagaaagtt ggataatgat gcactcaaca
    12421 acattatcaa caatgcaaga gatggttgtg ttcccttgaa cataatacct cttacaacag
    12481 cagccaaact aatggttgtc ataccagact ataacacata taaaaatacg tgtgatggta
    12541 caacatttac ttatgcatca gcattgtggg aaatccaaca ggttgtagat gcagatagta
    12601 aaattgttca acttagtgaa attagtatgg acaattcacc taatttagca tggcctctta
    12661 ttgtaacagc tttaagggcc aattctgctg tcaaattaca gaataatgag cttagtcctg
    12721 ttgcactacg acagatgtct tgtgctgccg gtactacaca aactgcttgc actgatgaca
    12781 atgcgttagc ttactacaac acaacaaagg gaggtaggtt tgtacttgca ctgttatccg
    12841 atttacagga tttgaaatgg gctagattcc ctaagagtga tggaactggt actatctata
    12901 cagaactgga accaccttgt aggtttgtta cagacacacc taaaggtcct aaagtgaagt
    12961 atttatactt tattaaagga ttaaacaacc taaatagagg tatggtactt ggtagtttag
    13021 ctgccacagt acgtctacaa gctggtaatg caacagaagt gcctgccaat tcaactgtat
    13081 tatctttctg tgcttttgct gtagatgctg ctaaagctta caaagattat ctagctagtg
    13141 ggggacaacc aatcactaat tgtgttaaga tgttgtgtac acacactggt actggtcagg
    13201 caataacagt tacaccggaa gccaatatgg atcaagaatc ctttggtggt gcatcgtgtt
    13261 gtctgtactg ccgttgccac atagatcatc caaatcctaa aggattttgt gacttaaaag
    13321 gtaagtatgt acaaatacct acaacttgtg ctaatgaccc tgtgggtttt acacttaaaa
    13381 acacagtctg taccgtctgc ggtatgtgga aaggttatgg ctgtagttgt gatcaactcc
    13441 gcgaacccat gcttcagtca gctgatgcac aatcgttttt aaacgggttt gcggtgtaag
    13501 tgcagcccgt cttacaccgt gcggcacagg cactagtact gatgtcgtat acagggcttt
    13561 tgacatctac aatgataaag tagctggttt tgctaaattc ctaaaaacta attgttgtcg
    13621 cttccaagaa aaggacgaag atgacaattt aattgattct tactttgtag ttaagagaca
    13681 cactttctct aactaccaac atgaagaaac aatttataat ttacttaagg attgtccagc
    13741 tgttgctaaa catgacttct ttaagtttag aatagacggt gacatggtac cacatatatc
    13801 acgtcaacgt cttactaaat acacaatggc agacctcgtc tatgctttaa ggcattttga
    13861 tgaaggtaat tgtgacacat taaaagaaat acttgtcaca tacaattgtt gtgatgatga
    13921 ttatttcaat aaaaaggact ggtatgattt tgtagaaaac ccagatatat tacgcgtata
    13981 cgccaactta ggtgaacgtg tacgccaagc tttgttaaaa acagtacaat tctgtgatgc
    14041 catgcgaaat gctggtattg ttggtgtact gacattagat aatcaagatc tcaatggtaa
    14101 ctggtatgat ttcggtgatt tcatacaaac cacgccaggt agtggagttc ctgttgtaga
    14161 ttcttattat tcattgttaa tgcctatatt aaccttgacc agggctttaa ctgcagagtc
    14221 acatgttgac actgacttaa caaagcctta cattaagtgg gatttgttaa aatatgactt
    14281 cacggaagag aggttaaaac tctttgaccg ttattttaaa tattgggatc agacatacca
    14341 cccaaattgt gttaactgtt tggatgacag atgcattctg cattgtgcaa actttaatgt
    14401 tttattctct acagtgttcc cacctacaag ttttggacca ctagtgagaa aaatatttgt
    14461 tgatggtgtt ccatttgtag tttcaactgg ataccacttc agagagctag gtgttgtaca
    14521 taatcaggat gtaaacttac atagctctag acttagtttt aaggaattac ttgtgtatgc
    14581 tgctgaccct gctatgcacg ctgcttctgg taatctatta ctagataaac gcactacgtg
    14641 cttttcagta gctgcactta ctaacaatgt tgcttttcaa actgtcaaac ccggtaattt
    14701 taacaaagac ttctatgact ttgctgtgtc taagggtttc tttaaggaag gaagttctgt
    14761 tgaattaaaa cacttcttct ttgctcagga tggtaatgct gctatcagcg attatgacta
    14821 ctatcgttat aatctaccaa caatgtgtga tatcagacaa ctactatttg tagttgaagt
    14881 tgttgataag tactttgatt gttacgatgg tggctgtatt aatgctaacc aagtcatcgt
    14941 caacaaccta gacaaatcag ctggttttcc atttaataaa tggggtaagg ctagacttta
    15001 ttatgattca atgagttatg aggatcaaga tgcacttttc gcatatacaa aacgtaatgt
    15061 catccctact ataactcaaa tgaatcttaa gtatgccatt agtgcaaaga atagagctcg
    15121 caccgtagct ggtgtctcta tctgtagtac tatgaccaat agacagtttc atcaaaaatt
    15181 attgaaatca atagccgcca ctagaggagc tactgtagta attggaacaa gcaaattcta
    15241 tggtggttgg cacaacatgt taaaaactgt ttatagtgat gtagaaaacc ctcaccttat
    15301 gggttgggat tatcctaaat gtgatagagc catgcctaac atgcttagaa ttatggcctc
    15361 acttgttctt gctcgcaaac atacaacgtg ttgtagcttg tcacaccgtt tctatagatt
    15421 agctaatgag tgtgctcaag tattgagtga aatggtcatg tgtggcggtt cactatatgt
    15481 taaaccaggt ggaacctcat caggagatgc cacaactgct tatgctaata gtgtttttaa
    15541 catttgtcaa gctgtcacgg ccaatgttaa tgcactttta tctactgatg gtaacaaaat
    15601 tgccgataag tatgtccgca atttacaaca cagactttat gagtgtctct atagaaatag
    15661 agatgttgac acagactttg tgaatgagtt ttacgcatat ttgcgtaaac atttctcaat
    15721 gatgatactc tctgacgatg ctgttgtgtg tttcaatagc acttatgcat ctcaaggtct
    15781 agtggctagc ataaagaact ttaagtcagt tctttattat caaaacaatg tttttatgtc
    15841 tgaagcaaaa tgttggactg agactgacct tactaaagga cctcatgaat tttgctctca
    15901 acatacaatg ctagttaaac agggtgatga ttatgtgtac cttccttacc cagatccatc
    15961 aagaatccta ggggccggct gttttgtaga tgatatcgta aaaacagatg gtacacttat
    16021 gattgaacgg ttcgtgtctt tagctataga tgcttaccca cttactaaac atcctaatca
    16081 ggagtatgct gatgtctttc atttgtactt acaatacata agaaagctac atgatgagtt
    16141 aacaggacac atgttagaca tgtattctgt tatgcttact aatgataaca cttcaaggta
    16201 ttgggaacct gagttttatg aggctatgta cacaccgcat acagtcttac aggctgttgg
    16261 ggcttgtgtt ctttgcaatt cacagacttc attaagatgt ggtgcttgca tacgtagacc
    16321 attcttatgt tgtaaatgct gttacgacca tgtcatatca acatcacata aattagtctt
    16381 gtctgttaat ccgtatgttt gcaatgctcc aggttgtgat gtcacagatg tgactcaact
    16441

联系我们

联系人:

手 机:0571-88254427

邮 箱:info@neuro-hemin.com

公 司:杭州纽罗西敏生物科技有限公司

地 址:杭州市教工路316号